PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30174.m009166
Common NameRCOM_1622300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 468aa    MW: 51317.7 Da    PI: 8.0466
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30174.m009166genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.63e-34184240259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    dDgynWrKYGqK+vkgsefprsYY+Ct+++Cpvkkkvers  d++v+ei+Y+g+Hnh+
  30174.m009166 184 DDGYNWRKYGQKQVKGSEFPRSYYKCTHPSCPVKKKVERSL-DGQVTEIIYKGQHNHH 240
                    8****************************************.***************7 PP

2WRKY103.98.5e-33355413159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK vkg+++prsYY+Ct+ gC+v+k+ver+a+dp++v++tYeg+Hnh+
  30174.m009166 355 LDDGYRWRKYGQKIVKGNPYPRSYYKCTTVGCKVRKHVERAATDPRAVVTTYEGKHNHD 413
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-30171242IPR003657WRKY domain
SuperFamilySSF1182902.48E-26181242IPR003657WRKY domain
SMARTSM007746.8E-38183241IPR003657WRKY domain
PfamPF031065.4E-26184240IPR003657WRKY domain
PROSITE profilePS5081123.594184242IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.9E-36340415IPR003657WRKY domain
SuperFamilySSF1182902.75E-29347415IPR003657WRKY domain
PROSITE profilePS5081138.136350415IPR003657WRKY domain
SMARTSM007746.4E-38355414IPR003657WRKY domain
PfamPF031061.4E-25356413IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MGLGLGFSPG PMTLVSSFFS DSDDFKSFSQ LLAGAMASPA AVKAPPFPPA QEDKISAIGV  60
TRTPANLSIV PPPPTFSPVA LLDSPGFGFF SPQGPFGMTH QQALAQVTAQ AAEANSHIHI  120
QAQYSSAPAT SSTQFSSIST NSTIHQQMPS SIPDTNASEK ELSDFSFPDQ RAQASSVTVD  180
KPADDGYNWR KYGQKQVKGS EFPRSYYKCT HPSCPVKKKV ERSLDGQVTE IIYKGQHNHH  240
PPLPNKRGKD AGNMNGNQNN QTDSGLASQF QIGNVNKLKD RKDQESSQAM PEHLSGTSDS  300
EEVGDTETGI DENDEDEPEA KRRNTEVRVT EPVSSHRTVT EPRIIVQTTS EVDLLDDGYR  360
WRKYGQKIVK GNPYPRSYYK CTTVGCKVRK HVERAATDPR AVVTTYEGKH NHDVPAAKGS  420
SHNIAHSNSS ELKQQNVEKN AVNNRRRDSS TNNRPPIARL RLKEEQIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-43184416878Probable WRKY transcription factor 4
2lex_A8e-43184416878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002512134.20.0PREDICTED: probable WRKY transcription factor 3
SwissprotQ9ZQ701e-173WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLB9RCY60.0B9RCY6_RICCO; WRKY transcription factor, putative
STRINGPOPTR_0010s17040.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF154534100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-140WRKY DNA-binding protein 3